Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis
Open accessAbstract
The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development.
The claims and statistics of this paper haven’t been checked yet.
Run the check — free, no account needed. It reads the open-access text and checks the sources it cites.
Integrity signals
Registry
Cites
Statistics
Claims the paper makes
The claims and statistics of this paper haven’t been checked yet.
Run the check — free, no account needed. It reads the open-access text and checks the sources it cites.
Claims other papers make about this one
Each is checked against this paper’s own text: does it say what the citing paper says it does?
Cathelicidins and defensins are a family of antimicrobial peptides that show a wide spectrum of antimicrobial activity against bacteria, enveloped viruses, and fungi.
“Cathelicidins and defensins are a family of antimicrobial peptides that show a wide spectrum of antimicrobial activity against bacteria, enveloped viruses, and fungi [176].”
From The Role of Reactive Species on Innate Immunity (2022) · cites this paper as [176]
Self-check
Percentages, sums and reported differences re-computed from the paper’s own numbers.
The self-check needs the paper’s full text.
Cites
Krogh, A., Larsson, B., von Heijne, G., & Sonnhammer, E. L. L. (2001) · Journal of Molecular Biology · doi:10.1006/jmbi.2000.4315 · Cited by 12,654 · see citing works
Protein Identification and Analysis Tools on the ExPASy Server
Gasteiger, E., Hoogland, C., Gattiker, A., Duvaud, S., Wilkins, M. R., Appel, R. D., & Bairoch, A. (2005) · Humana Press eBooks · doi:10.1385/1-59259-890-0:571 · Cited by 10,133 · see citing works
ColabFold - Making protein folding accessible to all
Mirdita, M., Schütze, K., Moriwaki, Y., Heo, L., Ovchinnikov, S., & Steinegger, M. (2021) · doi:10.1101/2021.08.15.456425 · Cited by 9,391 · see citing works
UCSF ChimeraX : Structure visualization for researchers, educators, and developers
Pettersen, E. F., Goddard, T. D., Huang, C. C., Meng, E. C., Couch, G. S., Croll, T. I., Morris, J. H., & Ferrin, T. E. (2020) · Protein Science · doi:10.1002/pro.3943 · Cited by 9,327 · see citing works
Protein secondary structure prediction based on position-specific scoring matrices.
Jones, D. C. (1999) · Journal of Molecular Biology · doi:10.1006/jmbi.1999.3091 · Cited by 5,741 · see citing works
A hidden Markov model for predicting transmembrane helices in protein sequences.
Sonnhammer, E. L. L., von HEIJNE, G., & Krogh, A. (1998) · PubMed · Cited by 2,483 · see citing works
OPM database and PPM web server: resources for positioning of proteins in membranes
Lomize, M. A., Pogozheva, I. D., Joo, H., Mosberg, H. I., & Lomize, A. L. (2011) · Nucleic Acids Research · doi:10.1093/nar/gkr703 · Cited by 2,126 · see citing works
Antimicrobial host defence peptides: functions and clinical potential
Mookherjee, N., Anderson, M. A., Haagsman, H. P., & Davidson, D. J. (2020) · Nature Reviews Drug Discovery · doi:10.1038/s41573-019-0058-8 · Cited by 1,502 · see citing works
COBALT: constraint-based alignment tool for multiple protein sequences
Papadopoulos, J. S., & Agarwala, R. (2007) · Bioinformatics · doi:10.1093/bioinformatics/btm076 · Cited by 1,130 · see citing works
The Minimum Inhibitory Concentration of Antibiotics: Methods, Interpretation, Clinical Relevance
Kowalska−Krochmal, B., & Dudek-Wicher, R. K. (2021) · Pathogens · doi:10.3390/pathogens10020165 · Cited by 1,107 · see citing works
The co-evolution of host cationic antimicrobial peptides and microbial resistance
Peschel, A., & Sahl, H. (2006) · Nature Reviews Microbiology · doi:10.1038/nrmicro1441 · Cited by 1,052 · see citing works
Cathelicidins, multifunctional peptides of the innate immunity
Zanetti, M. (2004) · Journal of Leukocyte Biology · doi:10.1189/jlb.0403147 · Cited by 988 · see citing works
CDD: conserved domains and protein three-dimensional structure
Marchler‐Bauer, A., Zheng, C., Chitsaz, F., Derbyshire, M. K., Geer, L. Y., Geer, R. C., Gonzales, N. R., Gwadz, M., Hurwitz, D. I., Lanczycki, C. J., et al. (2012) · Nucleic Acids Research · doi:10.1093/nar/gks1243 · Cited by 872 · see citing works
Activities of LL-37, a Cathelin-Associated Antimicrobial Peptide of Human Neutrophils
Turner, J., Cho, Y., Dinh, N.-N., Waring, A. J., & Lehrer, R. I. (1998) · Antimicrobial Agents and Chemotherapy · doi:10.1128/aac.42.9.2206 · Cited by 800 · see citing works
Campylobacters as zoonotic pathogens: A food production perspective
Humphrey, T., O’Brien, S. J., & Madsen, M. (2007) · International Journal of Food Microbiology · doi:10.1016/j.ijfoodmicro.2007.01.006 · Cited by 753 · see citing works
Pirtskhalava, M., Amstrong, A. A., Grigolava, M., Chubinidze, M., Alimbarashvili, E., Vishnepolsky, B., Gabrielian, A. E., Rosenthal, A., Hurt, D. E., & Tartakovsky, M. (2020) · Nucleic Acids Research · doi:10.1093/nar/gkaa991 · Cited by 725 · see citing works
Waghu, F. H., Barai, R. S., Gurung, P., & Idicula-Thomas, S. (2016) · Nucleic Acids Research · doi:10.1093/nar/gkv1051 · Cited by 715 · see citing works
Ageitos, J. M., Sánchez-Pérez, A., Calo‐Mata, P., & Villa, T. G. (2016) · Biochemical Pharmacology · doi:10.1016/j.bcp.2016.09.018 · Cited by 616 · see citing works
A New Era of Antibiotics: The Clinical Potential of Antimicrobial Peptides
Browne, K., Chakraborty, S., Chen, R., Willcox, M. D. P., Black, D. S., Walsh, W. R., & Kumar, N. (2020) · International Journal of Molecular Sciences · doi:10.3390/ijms21197047 · Cited by 485 · see citing works
Antimicrobial Peptides: Features, Action, and Their Resistance Mechanisms in Bacteria
Moravej, H., Moravej, Z., Yazdanparast, M., Heiat, M., Mirhosseini, S. A., Moghaddam, M. M., & Mirnejad, R. (2018) · Microbial Drug Resistance · doi:10.1089/mdr.2017.0392 · Cited by 417 · see citing works
The Role of Cathelicidins in the Innate Host Defenses of Mammals
Zanetti, M. (2005) · Current Issues in Molecular Biology · doi:10.21775/cimb.007.179 · Cited by 413 · see citing works
Spatial arrangement of proteins in planar and curved membranes by PPM 3.0
Lomize, A. L., Todd, S. C., & Pogozheva, I. D. (2021) · Protein Science · doi:10.1002/pro.4219 · Cited by 348 · see citing works
AVPpred: collection and prediction of highly effective antiviral peptides.
Thakur, N., Qureshi, A., & Kumar, M. (2012) · Nucleic Acids Research · doi:10.1093/nar/gks450 · Cited by 324 · see citing works
Antimicrobial peptides: New candidates in the fight against bacterial infections
Tőke, O. (2005) · Biopolymers · doi:10.1002/bip.20286 · Cited by 322 · see citing works
A Brief History of Protein Sorting Prediction
Nielsen, H., Tsirigos, K. D., Brunak, S., & von HEIJNE, G. (2019) · The Protein Journal · doi:10.1007/s10930-019-09838-3 · Cited by 301 · see citing works
Desper, R. (2003) · Molecular Biology and Evolution · doi:10.1093/molbev/msh049 · Cited by 279 · see citing works
Immunomodulatory Properties of Defensins and Cathelicidins
Bowdish, D. M. E., Davidson, D. J., & Hancock, R. E. W. (2006) · Current topics in microbiology and immunology · doi:10.1007/3-540-29916-5_2 · Cited by 268 · see citing works
Cathelicidins: Immunomodulatory Antimicrobials
van Harten, R. M., van Woudenbergh, E., van Dijk, A. I. J. M., & Haagsman, H. P. (2018) · Vaccines · doi:10.3390/vaccines6030063 · Cited by 260 · see citing works
The Cathelicidins - Structure, Function and Evolution
Tomasinsig, L., & Zanetti, M. (2005) · Current Protein and Peptide Science · doi:10.2174/1389203053027520 · Cited by 254 · see citing works
Cathelicidins Modulate TLR-Activation and Inflammation
Scheenstra, M. R., van Harten, R. M., Veldhuizen, E. J. A., Haagsman, H. P., & Coorens, M. (2020) · Frontiers in Immunology · doi:10.3389/fimmu.2020.01137 · Cited by 164 · see citing works
Design of Antimicrobial Peptides: Progress Made with Human Cathelicidin LL-37
Wang, G., Narayana, J. L., Mishra, B., Zhang, Y., Wang, F., Wang, C., Zarena, D., Lushnikova, T., & Wang, X. (2019) · Advances in experimental medicine and biology · doi:10.1007/978-981-13-3588-4_12 · Cited by 152 · see citing works
Collection of antimicrobial peptides database and its derivatives: Applications and beyond
Waghu, F. H., & Idicula‐Thomas, S. (2019) · Protein Science · doi:10.1002/pro.3714 · Cited by 144 · see citing works
Nagaoka, I., Tamura, H., & Reich, J. (2020) · International Journal of Molecular Sciences · doi:10.3390/ijms21175973 · Cited by 141 · see citing works
The Road from Host-Defense Peptides to a New Generation of Antimicrobial Drugs
Boto, A., Pérez de la Lastra, J., & González, C. (2018) · Molecules · doi:10.3390/molecules23020311 · Cited by 136 · see citing works
Self-citationPhysicochemical Features and Peculiarities of Interaction of AMP with the Membrane
Pirtskhalava, M., Vishnepolsky, B., Grigolava, M., & Managadze, G. (2021) · Pharmaceuticals · doi:10.3390/ph14050471 · Cited by 123 · see citing works
Grishin, N. (1995) · Journal of Molecular Evolution · doi:10.1007/bf00175826 · Cited by 107 · see citing works
Coorens, M., Scheenstra, M. R., Veldhuizen, E. J. A., & Haagsman, H. P. (2017) · Scientific Reports · doi:10.1038/srep40874 · Cited by 99 · see citing works
Charoenkwan, P., Chiangjong, W., Lee, V. S., Nantasenamat, C., Hasan, M. M., & Shoombuatong, W. (2021) · Scientific Reports · doi:10.1038/s41598-021-82513-9 · Cited by 80 · see citing works
Young‐Speirs, M., Drouin, D., Cavalcante, P. A., Barkema, H. W., & Cobo, E. R. (2018) · International Journal of Antimicrobial Agents · doi:10.1016/j.ijantimicag.2018.02.006 · Cited by 71 · see citing works
Antimicrobial Peptides: The LPS Connection
Giuliani, A., Pirri, G., & Rinaldi, A. C. (2009) · Methods in molecular biology · doi:10.1007/978-1-60761-594-1_10 · Cited by 65 · see citing works
Luo, X., Li, J., Huang, H., Duan, J., Dai, R., Tao, R., Yang, L., Hou, J., Jia, X., & Xu, J. (2019) · Frontiers in Immunology · doi:10.3389/fimmu.2019.00283 · Cited by 64 · see citing works
Park, T., Baek, M., Lee, H., & Seok, C. (2019) · Journal of Computational Chemistry · doi:10.1002/jcc.25874 · Cited by 54 · see citing works
Rico-Mata, R., Rodriguez, L. M. D. L., & Ávila, E. E. (2012) · Experimental Parasitology · doi:10.1016/j.exppara.2012.12.009 · Cited by 53 · see citing works
Host defense peptides: An insight into the antimicrobial world
Gupta, S., Bhatia, G., Sharma, A., & Saxena, S. (2018) · Journal of Oral and Maxillofacial Pathology · doi:10.4103/jomfp.jomfp_113_16 · Cited by 50 · see citing works
Giuliani, A., eds, & RINALDI, A. (2010) · Methods in molecular biology · doi:10.1007/978-1-60761-594-1 · Cited by 33 · see citing works
Novelties of conception in insectivorous mammals (Lipotyphla), particularly shrews
BEDFORD, J. M., Mock, O. B., & Goodman, S. M. (2004) · Biological reviews/Biological reviews of the Cambridge Philosophical Society · doi:10.1017/s1464793104006529 · Cited by 32 · see citing works
Developmental Stages and Growth Rate of the Mole Talpa occidentalis (Insectivora, Mammalia)
Barrionuevo, F. J., Zurita, F., Burgos, M., et al. (2004) · Journal of Mammalogy · doi:10.1644/bpr-010 · Cited by 28 · see citing works
Chakraborty, S., Chatterjee, R., & Chakravortty, D. (2022) · Computational and Structural Biotechnology Journal · doi:10.1016/j.csbj.2022.05.002 · Cited by 26 · see citing works
Oliveira-Júnior, N. G., Cardoso, M. H. E. S., Velikova, N., et al. (2020) · Scientific Reports · doi:10.1038/s41598-020-66164-w · Cited by 24 · see citing works
New records for Anaplasma phagocytophilum infection in small mammal species
Matei, I. A., D’Amico, G., Ionică, A. M., et al. (2018) · Parasites & Vectors · doi:10.1186/s13071-018-2791-y · Cited by 21 · see citing works
Cho, H., Soundrarajan, N., Le, Q. V. C., Jeon, H., Cha, S.-Y., Kang, M., Ahn, B., Hong, K., Song, H., Kim, J., et al. (2018) · Gene · doi:10.1016/j.gene.2018.07.005 · Cited by 18 · see citing works
Lukyanova, L. E., Ukhova, N. L., Ухова, О. В., et al. (2021) · Russian Journal of Ecology · doi:10.1134/s106741362104007x · Cited by 15 · see citing works
Bioinformatic Analysis of Genome-Predicted Bat Cathelicidins
de la Lastra, J. M. P., Asensio‐Calavia, P., González-Acosta, S., Baca-González, V., & Morales-delaNuez, A. (2021) · Molecules · doi:10.3390/molecules26061811 · Cited by 14 · see citing works
Self-citationWild boars as reservoir for Campylobacter and Arcobacter
Kerkhof, P.-J., Peruzy, M. F., Murru, N., et al. (2022) · Veterinary Microbiology · doi:10.1016/j.vetmic.2022.109462 · Cited by 13 · see citing works
Insectivores (Insectivora, Macroscelidea, Scandentia)
D’Agostino, J. (2014) · Elsevier eBooks · doi:10.1016/b978-1-4557-7397-8.00034-7 · Cited by 11 · see citing works
Hedgehogs, shrews, moles, and solenodons (Eulipotyphla)
Douadya, C. J., & Douzeryd, E. J. P. (2009) · doi:10.1093/oso/9780199535033.003.0077 · Cited by 9 · see citing works
Stepanova, I. P., Andreychev, A., KULAKHMETOV, R., et al. (2021) · Biodiversitas Journal of Biological Diversity · doi:10.13057/biodiv/d221059 · Cited by 7 · see citing works
Antimicrobial activity of cathelicidins of mammals from avian, aquatic and terrestrial environments
de la Lastra, J. M. P., Garrido-Orduña, C., Borges, L., et al. (2016) · Cited by 5 · see citing works
Cathelicidin in Gastrointestinal Disorders
Shen, J., & Xiao, Z. (2018) · Elsevier eBooks · doi:10.1016/b978-0-12-814319-3.00004-0 · Cited by 3 · see citing works
Flagged first, then by citations
Research works printed but not linked: 1
- [13]Souvorov A. Kapustin Y. Kiryutin B. Chetvernin V. Tatusova T. Lipman D. Gnomon–NCBI eukaryotic gene prediction tool Natl. Cent. Biotechnol. Inf. 2010 1 24 Available online: https://www.ncbi.nlm.nih.gov/genome/annotation_euk/gnomon (accessed on 9 May 2022)
Cited by
Sorted by citations
The Role of Reactive Species on Innate Immunity
Andrés, C., Pérez de la Lastra, J., Juan, C., Plou, F., & Pérez-Lebeña, E. (2022) · Vaccines · doi:10.3390/vaccines10101735 · Cited by 142 · see citing works
Self-citation
- Authors
- Otazo-Pérez, A., Asensio-Calavia, P., González-Acosta, S., Baca-González, V., López, M. R., Morales-delaNuez, A., & Pérez de la Lastra, J. M.
- Affiliations
- Biotechnology of Macromolecules Research Group, Instituto de Productos Naturales y Agrobiología (IPNA-CSIC), Avda. Astrofísico Francisco Sánchez, 3, 38206 San Cristóbal de la Laguna, Spain
- Consejo Superior de Investigaciones Científicas (ES)
- ORCID
- Venue
- Vaccines
- Publisher
- MDPI AG
- Published
- 2022-07-10
- Volume
- 10
- Issue
- 7
- Pages
- 1105
- ISSN
- 2076-393X (ISSN-L)
- PMC
- PMC9323388
- OpenAlex
- W4285007986
- Cited by
- 9
- References
- 59
- Citations by year
- 2025: 1 · 2024: 5 · 2022: 2
- FWCI
- 1.25
- Type
- journal article
- Language
- en
- Open access
- gold
- doi.org
- Licence
- Locations
- Vaccines (publishedVersion, cc-by)
- PubMed Central (publishedVersion, cc-by)
- PubMed (publishedVersion)
- Acceda (Universidad de Las Palmas de Gran Canaria) (submittedVersion)
- DIGITAL.CSIC (Spanish National Research Council (CSIC)) (submittedVersion, cc-by)
- DOAJ (DOAJ: Directory of Open Access Journals) (submittedVersion, cc-by-sa)
- Funders
- Agencia Canaria de Investigación, Innovación y Sociedad de la Información (ACIISI) del Gobierno de Canarias (ProID2020010134, 2019SP43)
- Fundación Cajacanarias (ProID2020010134, 2019SP43)
- Topics
- Life Sciences › Immunology and Microbiology › Microbiology › Antimicrobial Peptides and Activities
- Physical Sciences › Chemistry › Organic Chemistry › Antimicrobial agents and applications
- Life Sciences › Immunology and Microbiology › Immunology › Invertebrate Immune Response Mechanisms
- Keywords
- cathelicidin, antimicrobial peptides, Talpa occidentalis, antibacterial activity, antifungal activity, innate immunity, Eulipotyphla, insectivores, hemolysis, peptide design
About these checks
Registry, retraction, Cites and statistics results are computed, not judged, with one exception: a printed reference that no index lists is read once by a model before it counts as a citation error. Claims are extracted by a model and kept only when their quote appears verbatim in the text; each cited source is then checked, with a model’s help, for whether it says what the claim relies on. Those verdicts can be wrong — read the claim’s quote and the cited source before relying on one.
Statistics and arithmetic are recomputed, not judged.
Confidence bands are shown only for fields calibrated on our annotated test set. None is calibrated yet, so no band is shown.
What counts as a claim ›How we measure confidence ›How we check this ›
Are you an author, or do you see a problem with this page? Request a review
